PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7DS_A1673EBA1.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YB
Protein Properties Length: 293aa    MW: 31494.5 Da    PI: 5.3514
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7DS_A1673EBA1.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB153.92.9e-4822117196
                  NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylk 88 
                            vreqdr++Pianv+rim+++lPa+akis+dake +qecvsefisfvt+ea+++c+ e+rkt+n++d++wal  lGf+dyv pl+v+l+
  Traes_7DS_A1673EBA1.2  22 VREQDRLMPIANVIRIMRRALPAHAKISDDAKEAIQECVSEFISFVTGEANERCHMEHRKTVNAEDIVWALNRLGFDDYVVPLSVFLH 109
                            69************************************************************************************** PP

                  NF-YB  89 kyrelege 96 
                            + r+ e++
  Traes_7DS_A1673EBA1.2 110 RMRDPEAA 117
                            ***98865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.3E-4518119IPR009072Histone-fold
SuperFamilySSF471132.95E-3425124IPR009072Histone-fold
PfamPF008081.5E-242992IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.8E-145674No hitNo description
PROSITE patternPS0068505975IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.8E-147593No hitNo description
PRINTSPR006151.8E-1494112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MENADVPNGA TAPAPTQATP VVREQDRLMP IANVIRIMRR ALPAHAKISD DAKEAIQECV  60
SEFISFVTGE ANERCHMEHR KTVNAEDIVW ALNRLGFDDY VVPLSVFLHR MRDPEAATGG  120
AAAGDRRAVT SAPPRAAPPV LHAMPLHAQM QRPMYAPPAL VQVQNQMQRP IYAPPAPMQV  180
QNQVQWPMYA PPPPVQVQMQ RGVYAPQAPV QGYAVGITPV RANVDGQCQV FGGERAVAQQ  240
YYGYGYGEGS SNGGACADEE SSSNSVPVPG KGTGEPEPEP AAEESQGKPI QSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B5e-3723113494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A5e-3723113494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9027850.0GU902785.1 Triticum monococcum nuclear transcription factor Y subunit B1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A096UWC10.0A0A096UWC1_WHEAT; Uncharacterized protein
TrEMBLM8BX700.0M8BX70_AEGTA; Nuclear transcription factor Y subunit B-6
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.25e-51nuclear factor Y, subunit B6
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]